Product Description
Recombinant Human Ephrin-A4 (EFNA4), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: EFNA4
Alternative Names : Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4
Expression Region : 26-171aa
AA Sequence : LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
Sequence Info : Partial
Tag Info : C-terminal 6xHis-FC-tagged
Theoretical MW : 44.3 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to bind Human EphA7 in functional ELISA is less than 10 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Ephrin-A4 is a member of the ephrin ligand family which binds members of the Eph receptor family. All ligands share a conserved extracellular sequence, which most likely corresponds to the receptor binding domain. Ephrin-A4 consists of approximately 125 amino acids and includes four invariant cysteines, It has been shown to bind EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, and EphB1. Ephrin-A4 binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. It may play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.
Function : Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils.
Involvement in disease :
Subcellular location : Isoform 1: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families : Ephrin family
Tissue Specificity : Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
Paythway : MAPKsignalingpathway
Uniprot ID : P52798
Euro
British Pound
US Dollar