Recombinant Human Epididymal secretory glutathione peroxidase (GPX5)

Product Description

Recombinant Human Epididymal secretory glutathione peroxidase (GPX5) is available at Gentaur for Next week Delivery.

Gene Name: GPX5

Alternative Names : Epididymis-specific glutathione peroxidase-like protein

Expression Region : 1-100aa

AA Sequence : MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-Trx-tagged

Theoretical MW : 28.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.

Function : Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glutathione peroxidase family

Tissue Specificity : Epididymis.

Paythway : Th17celldifferentiation

Uniprot ID : O75715