Recombinant Human Epiplakin (EPPK1), partial

Product Description

Recombinant Human Epiplakin (EPPK1), partial is available at Gentaur for Next week Delivery.

Gene Name: EPPK1

Alternative Names : 450KDA epidermal antigen

Expression Region : 1-225aa

AA Sequence : MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Cytoskeletal linker protein that connects to intermediate filaments and controls their reorganization in response to stress

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, Cell junction, hemidesmosome, Cell junction, tight junction, Cell projection, Apicolateral cell membrane, Basolateral cell membrane, Cell junction

Protein Families : Plakin or cytolinker family

Tissue Specificity : Expressed in epithelial cells of liver, small intestine, colon, salivary glands, stomach and appendix.

Paythway :

Uniprot ID : P58107