Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial

Product Description

Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial is available at Gentaur for Next week Delivery.

Gene Name: EPCAM

Alternative Names : Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name: EGP Epithelial glycoprotein 314 Short name: EGP314 Short name: hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen: CD326

Expression Region : 24-265aa

AA Sequence : QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 43.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Tags & Cell Markers

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Function : May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Involvement in disease : Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)

Subcellular location : Lateral cell membrane, Single-pass type I membrane protein, Cell junction, tight junction

Protein Families : EPCAM family

Tissue Specificity : Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Paythway :

Uniprot ID : P16422