Recombinant Human Eukaryotic translation initiation factor 1 (EIF1)

Product Description

Recombinant Human Eukaryotic translation initiation factor 1 (EIF1) is available at Gentaur for Next week Delivery.

Gene Name: EIF1

Alternative Names : A121;Protein translation factor SUI1 homologSui1iso1

Expression Region : 1-113aa

AA Sequence : MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Necessary for scanning and involved in initiation site selection. Promotes the assbly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Function : Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Involvement in disease :

Subcellular location :

Protein Families : SUI1 family

Tissue Specificity :

Paythway :

Uniprot ID : P41567