Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3)

Product Description

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 3 (EIF4EBP3) is available at Gentaur for Next week Delivery.

Gene Name: EIF4EBP3

Alternative Names :

Expression Region : 1-100aa

AA Sequence : MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 26.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.

Function : Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex

Involvement in disease :

Subcellular location :

Protein Families : EIF4E-binding protein family

Tissue Specificity : Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus.

Paythway :

Uniprot ID : O60516