Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial

Product Description

Recombinant Human Excitatory amino acid transporter 4 (SLC1A6), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC1A6

Alternative Names : Sodium-dependent glutamate/aspartate transporter Solute carrier family 1 member 6

Expression Region : 149-271aa

AA Sequence : MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transports L-glutamate and also L- and D-aspartate. Seems to act as a symport by cotransporting sodium.

Function : Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A6 subfamily

Tissue Specificity : Brain. Expressed densely and selectively in cell bodies of Purkinje cells.

Paythway : Glutamatergicsynapse

Uniprot ID : P48664