Product Description
Recombinant Human Extracellular domain calcium-sensing receptor (CASR), partial is available at Gentaur for Next week Delivery.
Gene Name: CASR
Alternative Names : Parathyroid cell calcium-sensing receptor 1;PCaR1
Expression Region : 20-612aa
AA Sequence : YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPF
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 68.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Senses changes in the Extracellular domain concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger syst.
Function : G-protein-coupled receptor that senses changes in the extracellular concentration of calcium ions and plays a key role in maintaining calcium homeostasis
Involvement in disease : Hypocalciuric hypercalcemia, familial 1 (HHC1); Hyperparathyroidism, neonatal severe (NSHPT); Hypocalcemia, autosomal dominant 1 (HYPOC1); Epilepsy, idiopathic generalized 8 (EIG8)
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families : G-protein coupled receptor 3 family
Tissue Specificity : Expressed in the temporal lobe, frontal lobe, parietal lobe, hippocampus, and cerebellum. Also found in kidney, lung, liver, heart, skeletal muscle, placenta.
Paythway : NOD-likereceptorsignalingpathway
Uniprot ID : P41180
Euro
British Pound
US Dollar