Recombinant Human Fibroblast growth factor 1 (FGF1) (Active)

Product Description

Recombinant Human Fibroblast growth factor 1 (FGF1) (Active) is available at Gentaur for Next week Delivery.

Gene Name: FGF1

Alternative Names : Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA

Expression Region : 16-155aa

AA Sequence : FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 15.9 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : FGF acidic, also known as ECGF, FGF-1and HBGF-1, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. It is a mitogenic peptide that is produced by multiple cell types and stimulates the proliferation of cells of mesodermal, ectodermal, and endodermal origin. Its association with heparan sulfate is a prerequisite for activation of FGF receptors. Internalized FGF acidic migrates to the nucleus where it is phosphorylated by nuclear PKC delta, exported to the cytosol, dephosphorylated, and degraded. Intracellular FGF acidic inhibits p53 activity and proapoptotic signaling.

Function : Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV

Involvement in disease :

Subcellular location : Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle.

Paythway : Hipposignalingpathway

Uniprot ID : P05230