Recombinant Human Fibroblast growth factor 10 (FGF10)

Product Description

Recombinant Human Fibroblast growth factor 10 (FGF10) is available at Gentaur for Next week Delivery.

Gene Name: FGF10

Alternative Names : Keratinocyte growth factor 2

Expression Region : 38-208aa

AA Sequence : QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Function : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.

Involvement in disease : Aplasia of lacrimal and salivary glands (ALSG); Lacrimo-auriculo-dento-digital syndrome (LADDS)

Subcellular location : Secreted

Protein Families : Heparin-binding growth factors family

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : O15520