Product Description
Recombinant Human Fibroblast growth factor 10 (FGF10), partial is available at Gentaur for Next week Delivery.
Gene Name: FGF10
Alternative Names : Keratinocyte growth factor 2
Expression Region : 41-208aa
AA Sequence : GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 35 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
Function : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
Involvement in disease : Aplasia of lacrimal and salivary glands (ALSG); Lacrimo-auriculo-dento-digital syndrome (LADDS)
Subcellular location : Secreted
Protein Families : Heparin-binding growth factors family
Tissue Specificity :
Paythway : MAPKsignalingpathway
Uniprot ID : O15520
Euro
British Pound
US Dollar