Recombinant Human Fibroblast growth factor 12 (FGF12)

Product Description

Recombinant Human Fibroblast growth factor 12 (FGF12) is available at Gentaur for Next week Delivery.

Gene Name: FGF12

Alternative Names : Fibroblast growth factor homologous factor 1

Expression Region : 1-181aa

AA Sequence : MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in nervous system development and function. Promote neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.

Function : Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.

Involvement in disease : Epileptic encephalopathy, early infantile, 47 (EIEE47)

Subcellular location : Nucleus

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.

Paythway :

Uniprot ID : P61328