Recombinant Human Fibroblast growth factor 17 (FGF17) (Active)

Product Description

Recombinant Human Fibroblast growth factor 17 (FGF17) (Active) is available at Gentaur for Next week Delivery.

Gene Name: FGF17

Alternative Names : Fibroblast Growth Factor 17; FGF-17; FGF17

Expression Region : 23-216aa

AA Sequence : TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 22.6 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.

Function : Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.

Involvement in disease : Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)

Subcellular location : Secreted

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Preferentially expressed in the embryonic brain.

Paythway : MAPKsignalingpathway

Uniprot ID : O60258