Product Description
Recombinant Human Fibroblast growth factor 17 (FGF17) (Active) is available at Gentaur for Next week Delivery.
Gene Name: FGF17
Alternative Names : Fibroblast Growth Factor 17; FGF-17; FGF17
Expression Region : 23-216aa
AA Sequence : TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 22.6 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.
Function : Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Involvement in disease : Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)
Subcellular location : Secreted
Protein Families : Heparin-binding growth factors family
Tissue Specificity : Preferentially expressed in the embryonic brain.
Paythway : MAPKsignalingpathway
Uniprot ID : O60258
Euro
British Pound
US Dollar