Recombinant Human Fibroblast growth factor 19 protein (FGF-19) , partial

Product Description

Recombinant Human Fibroblast growth factor 19 protein (FGF-19) , partial is available at Gentaur for Next week Delivery.

Gene Name: FGF-19

Alternative Names :

Expression Region : 32-216aa

AA Sequence : PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.

Function : Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Expressed in fetal brain, cartilage, retina, and adult gall bladder.

Paythway : MAPKsignalingpathway

Uniprot ID : O95750