Euro
British Pound
US Dollar
Product Description
Recombinant Human Fibroblast growth factor 8 (FGF8), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: FGF8
Alternative Names : Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B
Expression Region : 23-244aa
AA Sequence : QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Sequence Info : Partial of Isoform 4
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 27.7 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 0.5 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Fibroblast growth factor 8 (FGF8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-dependent growth of mouse mammary carcinoma cells. Mouse FGF8b shares 100% aa identity with human FGF8b. FGF8 is widely expressed during embryogenesis, and mediates epithelial-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P55075-4
