Product Description
Recombinant Human Fibroleukin (FGL2) is available at Gentaur for Next week Delivery.
Gene Name: FGL2
Alternative Names : Fibrinogen-like protein 2 pT49
Expression Region : 24-439aa
AA Sequence : NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 49.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in physiologic lymphocyte functions at mucosal sites
Function : May play a role in physiologic lymphocyte functions at mucosal sites.
Involvement in disease :
Subcellular location : Secreted
Protein Families :
Tissue Specificity : Constitutively expressed in cytotoxic T-cells.
Paythway :
Uniprot ID : Q14314
Euro
British Pound
US Dollar