Recombinant Human Fibronectin (FN1), partial (Active)

Product Description

Recombinant Human Fibronectin (FN1), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: FN1

Alternative Names : NovoNectin;Fibronectin; FN; Cold-insoluble globulin; CIG; FN; Fibronectin 1

Expression Region : 1270-1546aa & 1721-2016aa

AA Sequence : PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS & AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST

Sequence Info : Dimer

Tag Info : Tag-Free

Theoretical MW : 62.7 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : Specific activity as determined by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells is greater than 50%. When 1×10^5 cells/well are added to plates coated with fibronectin (7-13 ng/mL and 100?L/well),approximately 50%-80% will adhere specifically after 30 minutes at 37?.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains,fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of ~63 kDa containing a central cell-binding domain, a high affinity heparin-binding domain II,and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on NovoNectin. This process enhances the density of both cells and vectors, and facilitates the gene transduction in the result.

Function : Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.; FUNCTION

Involvement in disease : Glomerulopathy with fibronectin deposits 2 (GFND2)

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families :

Tissue Specificity : Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. Ugl-Y1, Ugl-Y2 and Ugl-Y3 are found in urine.

Paythway : PI3K-Aktsignalingpathway

Uniprot ID : P02751