Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)

Product Description

Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1) is available at Gentaur for Next week Delivery.

Gene Name: FANK1

Alternative Names :

Expression Region : 1-345aa

AA Sequence : MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 54.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm, cytosol

Protein Families :

Tissue Specificity : Mostly restricted to testis.

Paythway :

Uniprot ID : Q8TC84