Euro
British Pound
US Dollar
Product Description
Recombinant Human Fibronectin type III domain-containing protein 5 (FNDC5), partial is available at Gentaur for Next week Delivery.
Gene Name: FNDC5
Alternative Names : Fibronectin type III repeat-containing protein 2
Expression Region : 32-143aa
AA Sequence : DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 28.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Irisin: Contrary to mouse, may not be involved in the beneficial effects of muscular exercise, nor in the induction of browning of human white adipose tissue.
Function : Irisin
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein, Peroxisome membrane, Single-pass type I membrane protein, Note=Imported in peroxisomes through the PEX5 receptor pathway, SUBCELLULAR LOCATION: Irisin: Secreted
Protein Families :
Tissue Specificity : Widely expressed, with highest levels in heart. Very low expression, if any, in colon, pancreas and spleen.
Paythway :
Uniprot ID : Q8NAU1
