Recombinant Human Folate receptor beta (FOLR2), partial

Product Description

Recombinant Human Folate receptor beta (FOLR2), partial is available at Gentaur for Next week Delivery.

Gene Name: FOLR2

Alternative Names : Folate receptor 2 Folate receptor, fetal/placental Placental folate-binding protein

Expression Region : 19-230aa

AA Sequence : CSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVN

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 27.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Function : Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted

Protein Families : Folate receptor family

Tissue Specificity : Expressed in placenta and hematopoietic cells. Expression is increased in malignant tissues.

Paythway : Endocytosis

Uniprot ID : P14207