Euro
British Pound
US Dollar
Product Description
Recombinant Human Forkhead box protein M1 (FOxM1), partial is available at Gentaur for Next week Delivery.
Gene Name: FOXM1
Alternative Names : Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11
Expression Region : 235-327aa
AA Sequence : ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Sequence Info : Partial
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 31.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Function : Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Involvement in disease :
Subcellular location : Nucleus
Protein Families :
Tissue Specificity : Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.
Paythway : Cellularsenescence
Uniprot ID : Q08050
