Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1)

Product Description

Recombinant Human G2/mitotic-specific cyclin-B1 (CCNB1) is available at Gentaur for Next week Delivery.

Gene Name: CCNB1

Alternative Names : CCNB

Expression Region : 1-433aa

AA Sequence : MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 50.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Function : Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families : Cyclin family, Cyclin AB subfamily

Tissue Specificity :

Paythway : p53signalingpathway

Uniprot ID : P14635