Recombinant Human Galectin-8 (LGALS8) (Active)

Product Description

Recombinant Human Galectin-8 (LGALS8) (Active) is available at Gentaur for Next week Delivery.

Gene Name: LGALS8

Alternative Names : Po66 carbohydrate-binding protein

Expression Region : 1-317aa

AA Sequence : MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 62.8 kDa

Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized SLC31A1 at 5 ?g/ml can bind human LGALS8, the EC50 of human LGALS8 is 373.90-524.30 ?g/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Lectin with a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : O00214