Product Description
Recombinant Human Gamma-aminobutyric acid receptor-associated protein (GABARAP), partial is available at Gentaur for Next week Delivery.
Gene Name: GABARAP
Alternative Names : GABA(A) receptor-associated protein;MM46
Expression Region : 2-117aa
AA Sequence : KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 40.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Function : Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Involvement in disease :
Subcellular location : Endomembrane system, Cytoplasm, cytoskeleton, Golgi apparatus membrane, Cytoplasmic vesicle, autophagosome, Cytoplasmic vesicle
Protein Families : ATG8 family
Tissue Specificity : Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.
Paythway : Autophagy-animal
Uniprot ID : O95166
Euro
British Pound
US Dollar