Recombinant Human Gamma-crystallin B (CRYGB)

Product Description

Recombinant Human Gamma-crystallin B (CRYGB) is available at Gentaur for Next week Delivery.

Gene Name: CRYGB

Alternative Names : Gamma-B-crystallin (Gamma-crystallin 1-2) (CRYG2)

Expression Region : 1-175aa

AA Sequence : MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 24.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Crystallins are the dominant structural components of the vertebrate eye lens.

Function : Crystallins are the dominant structural components of the vertebrate eye lens.

Involvement in disease : Cataract 39, multiple types (CTRCT39)

Subcellular location :

Protein Families : Beta/gamma-crystallin family

Tissue Specificity :

Paythway :

Uniprot ID : P07316