Recombinant Human Gamma-soluble NSF attachment protein (NAPG)

Product Description

Recombinant Human Gamma-soluble NSF attachment protein (NAPG) is available at Gentaur for Next week Delivery.

Gene Name: NAPG

Alternative Names : N-ethylmaleimide-sensitive factor attachment protein gamma

Expression Region : 1-312aa

AA Sequence : MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Sequence Info : Full Length of BC001889

Tag Info : N-terminal GST-tagged

Theoretical MW : 61.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Function : Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Involvement in disease :

Subcellular location : Membrane, Peripheral membrane protein

Protein Families : SNAP family

Tissue Specificity :

Paythway :

Uniprot ID : Q99747