Recombinant Human Gastrotropin (FABP6)

Product Description

Recombinant Human Gastrotropin (FABP6) is available at Gentaur for Next week Delivery.

Gene Name: FABP6

Alternative Names : Fatty acid-binding protein 6 Ileal lipid-binding protein

Expression Region : 1-128aa

AA Sequence : MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA

Sequence Info : Full Length of BC022489

Tag Info : N-terminal GST-tagged

Theoretical MW : 41.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes. In vitro binds to bile acids in the order: deoxycholic acid > cholic acid > chenodeoxycholic acid and respective BA conjugation modifies affinities in the order taurine-conjugated > glycine-conjugated > unconjugated bile acids. Stimulates gastric acid and pepsinogen secretion

Function : Binds to bile acids and is involved in enterohepatic bile acid metabolism. Required for efficient apical to basolateral transport of conjugated bile acids in ileal enterocytes (By similarity). In vitro binds to bile acids in the order

Involvement in disease :

Subcellular location : Isoform 1: Cytoplasm, Membrane, Peripheral membrane protein, Cytoplasmic side, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm

Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity : Isoform 1 is expressed in the jejunum, ileum, cecum and ascending colon intestine. Isoform 2 is xpressed in the gallbladder, duodenum, jejunum, ileum, cecum, ascending, transverse and descending colon, sigmoid colon and rectum. Isoform 2 is expressed in colorectal adenocarcinomas and their adjacent normal mucosa (at protein level).

Paythway : PPARsignalingpathway

Uniprot ID : P51161