Product Description
Recombinant Human Glial cell line-derived neurotrophic factor (GDNF) is available at Gentaur for Next week Delivery.
Gene Name: GDNF
Alternative Names : Astrocyte-derived trophic factor;ATF
Expression Region : 78-211aa
AA Sequence : SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 15.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Function : Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Involvement in disease : Hirschsprung disease 3 (HSCR3); Congenital central hypoventilation syndrome (CCHS); Pheochromocytoma (PCC)
Subcellular location : Secreted
Protein Families : TGF-beta family, GDNF subfamily
Tissue Specificity : In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic islets. Isoform 5 is expressed at very low levels in putamen, nucleus accumbens, prefrontal cortex, amygdala, hypothalamus and intestine. Isoform 3 is up-regulated in the middle temporal gyrus of Alzheimer disease patients while isoform 2 shows no change.
Paythway :
Uniprot ID : P39905
Euro
British Pound
US Dollar