Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Product Description

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial is available at Gentaur for Next week Delivery.

Gene Name: GLP1R

Alternative Names :

Expression Region : 24-145aa

AA Sequence : RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Function : G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 2 family

Tissue Specificity :

Paythway : cAMPsignalingpathway

Uniprot ID : P43220