Recombinant Human Glutaminyl-peptide cyclotransferase-like protein (QPCTL), partial

Product Description

Recombinant Human Glutaminyl-peptide cyclotransferase-like protein (QPCTL), partial is available at Gentaur for Next week Delivery.

Gene Name: QPCTL

Alternative Names : Golgi-resident glutaminyl-peptide cyclotransferaseisoQC;gQC

Expression Region : 212-382aa

AA Sequence : AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Responsible for the biosynthesis of pyroglutamyl peptides.

Function : Responsible for the biosynthesis of pyroglutamyl peptides.

Involvement in disease :

Subcellular location : Golgi apparatus membrane, Single-pass type I membrane protein

Protein Families : Glutaminyl-peptide cyclotransferase family

Tissue Specificity :

Paythway :

Uniprot ID : Q9NXS2