Recombinant Human Glutathione peroxidase 1 (GPX1)

Product Description

Recombinant Human Glutathione peroxidase 1 (GPX1) is available at Gentaur for Next week Delivery.

Gene Name: GPX1

Alternative Names : Cellular glutathione peroxidase

Expression Region : 1-203aa

AA Sequence : MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Protects the hoglobin in erythrocytes from oxidative breakdown.

Function : Protects the hemoglobin in erythrocytes from oxidative breakdown.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Glutathione peroxidase family

Tissue Specificity :

Paythway : Th17celldifferentiation

Uniprot ID : P07203