Recombinant Human Glutathione S-transferase A2 (GSTA2)

Product Description

Recombinant Human Glutathione S-transferase A2 (GSTA2) is available at Gentaur for Next week Delivery.

Gene Name: GSTA2

Alternative Names : GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2

Expression Region : 1-222aa

AA Sequence : MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Sequence Info : Full Length of BC002895

Tag Info : N-terminal GST-tagged

Theoretical MW : 52.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Function : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : GST superfamily, Alpha family

Tissue Specificity : Liver.

Paythway :

Uniprot ID : P09210