Recombinant Human Glutathione S-transferase A4 (GSTA4)

Product Description

Recombinant Human Glutathione S-transferase A4 (GSTA4) is available at Gentaur for Next week Delivery.

Gene Name: GSTA4

Alternative Names : GST class-alpha member 4Glutathione S-transferase A4-4

Expression Region : 1-222aa

AA Sequence : MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 41.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).

Function : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : GST superfamily, Alpha family

Tissue Specificity : Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.

Paythway :

Uniprot ID : O15217