Product Description
Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) (Active) is available at Gentaur for Next week Delivery.
Gene Name: GSTK1
Alternative Names : GST 13-13 GST class-kappa GSTK1-1
Expression Region : 2-226aa
AA Sequence : GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 52.4 kDa
Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 ?g/ml can bind human GSTK1,the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y2Q3