Product Description
Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: CSF3
Alternative Names : Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
Expression Region : 31-204aa
AA Sequence : TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Sequence Info : Partial of Isoform 2
Tag Info : Tag-Free
Theoretical MW : 18.8 kDa
Storage Buffer : Lyophilized from a 0.2 ?m Filtered 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using NFS?60 mouse myelogenous leukemia lymphoblast cells is less than 0.2 ng/ml
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Human Granulocyte-Colony-Stimulating Factor (G-CSF) is 20 kD glycoprotein containing internal disulfide bonds. It induces the survival, proliferation, and differentiation of neutrophilic granulocyte precursor cells and it functionally activates mature blood neutrophils. Among the family of colony-stimulating factors, G-CSF is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of G-CSF can be induced by bacterial endotoxins, TNF, Interleukin-1, and GM-CSF. Prostaglandin E2 inhibits the synthesis of G-CSF. In epithelial, endothelial, and fibroblastic cells secretion of G-CSF is induced by Interleukin-17.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P09919-2
Euro
British Pound
US Dollar