Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial (Active)

Product Description

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: CSF2RA

Alternative Names : Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

Expression Region : 23-320aa

AA Sequence : EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF?1 human erythroleukemic cells is less than 5 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit ? (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4).

Function : Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.

Involvement in disease : Pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Subcellular location : Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted

Protein Families : Type I cytokine receptor family, Type 5 subfamily

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P15509