Product Description
Recombinant Human Granzyme B (GZMB) is available at Gentaur for Next week Delivery.
Gene Name: GZMB
Alternative Names : C11CTLA-1Cathepsin G-like 1;CTSGL1Cytotoxic T-lymphocyte proteinase 2;Lymphocyte proteaseFragmentin-2Granzyme-2Human lymphocyte protein;HLPSECTT-cell serine protease 1-3E
Expression Region : 21-247aa
AA Sequence : IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 27.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Ses to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
Function : This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.
Involvement in disease :
Subcellular location : Cytoplasmic granule
Protein Families : Peptidase S1 family, Granzyme subfamily
Tissue Specificity :
Paythway : Apoptosis
Uniprot ID : P10144
Euro
British Pound
US Dollar