Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3)

Product Description

Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3) is available at Gentaur for Next week Delivery.

Gene Name: DIRAS3

Alternative Names : Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI

Expression Region : 1-229aa

AA Sequence : MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 52.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families : Small GTPase superfamily, Di-Ras family

Tissue Specificity : Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.

Paythway :

Uniprot ID : O95661