Product Description
Recombinant Human GTP-binding protein Di-Ras3 (DIRAS3) is available at Gentaur for Next week Delivery.
Gene Name: DIRAS3
Alternative Names : Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI
Expression Region : 1-229aa
AA Sequence : MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 52.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side
Protein Families : Small GTPase superfamily, Di-Ras family
Tissue Specificity : Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
Paythway :
Uniprot ID : O95661
Euro
British Pound
US Dollar