Recombinant Human GTPase ERas (ERAS), partial

Product Description

Recombinant Human GTPase ERas (ERAS), partial is available at Gentaur for Next week Delivery.

Gene Name: ERAS

Alternative Names : Embryonic stem cell-expressed Ras

Expression Region : 3-230aa

AA Sequence : LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of bryonic st cells .

Function : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells (By similarity).

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families : Small GTPase superfamily, Ras family

Tissue Specificity :

Paythway :

Uniprot ID : Q7Z444