Product Description
Recombinant Human GTPase KRas (KRAS), partial is available at Gentaur for Next week Delivery.
Gene Name: KRAS
Alternative Names : K-Ras 2Ki-Rasc-K-rasc-Ki-ras
Expression Region : 2-168aa
AA Sequence : TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 23.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications
Function : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation
Involvement in disease : Leukemia, acute myelogenous (AML); Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 3 (NS3); Gastric cancer (GASC); Cardiofaciocutaneous syndrome 2 (CFC2)
Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, cytosol
Protein Families : Small GTPase superfamily, Ras family
Tissue Specificity :
Paythway : Chemokinesignalingpathway
Uniprot ID : P01116
Euro
British Pound
US Dollar