Recombinant Human GTPase KRas (KRAS), partial

Product Description

Recombinant Human GTPase KRas (KRAS), partial is available at Gentaur for Next week Delivery.

Gene Name: KRAS

Alternative Names : K-Ras 2Ki-Rasc-K-rasc-Ki-ras

Expression Region : 2-168aa

AA Sequence : TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 23.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications

Function : Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation

Involvement in disease : Leukemia, acute myelogenous (AML); Leukemia, juvenile myelomonocytic (JMML); Noonan syndrome 3 (NS3); Gastric cancer (GASC); Cardiofaciocutaneous syndrome 2 (CFC2)

Subcellular location : Cell membrane, Lipid-anchor, Cytoplasmic side, Cytoplasm, cytosol

Protein Families : Small GTPase superfamily, Ras family

Tissue Specificity :

Paythway : Chemokinesignalingpathway

Uniprot ID : P01116