Recombinant Human Guanylate kinase (GUK1)

Product Description

Recombinant Human Guanylate kinase (GUK1) is available at Gentaur for Next week Delivery.

Gene Name: GUK1

Alternative Names : GMP kinase

Expression Region : 2-197aa

AA Sequence : SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 37.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Essential for recycling GMP and indirectly, cGMP.

Function : Essential for recycling GMP and indirectly, cGMP.

Involvement in disease :

Subcellular location :

Protein Families : Guanylate kinase family

Tissue Specificity :

Paythway :

Uniprot ID : Q16774