Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial

Product Description

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is available at Gentaur for Next week Delivery.

Gene Name: HEATR6

Alternative Names : Amplified in breast cancer protein 1 ABC1

Expression Region : 1052-1175aa

AA Sequence : KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 18.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Amplification-dependent oncogene.

Function : Amplification-dependent oncogene.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity : Amplified in breast cancer cell lines MCF-7 and BT-474.

Paythway :

Uniprot ID : Q6AI08