Product Description
Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial is available at Gentaur for Next week Delivery.
Gene Name: HEATR6
Alternative Names : Amplified in breast cancer protein 1 ABC1
Expression Region : 1052-1175aa
AA Sequence : KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 18.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Amplification-dependent oncogene.
Function : Amplification-dependent oncogene.
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity : Amplified in breast cancer cell lines MCF-7 and BT-474.
Paythway :
Uniprot ID : Q6AI08
Euro
British Pound
US Dollar