Recombinant Human Heat shock protein beta-2 (HSPB2)

Product Description

Recombinant Human Heat shock protein beta-2 (HSPB2) is available at Gentaur for Next week Delivery.

Gene Name: HSPB2

Alternative Names : DMPK-binding protein

Expression Region : 1-182aa

AA Sequence : MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May regulate the kinase DMPK.

Function : May regulate the kinase DMPK.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : Small heat shock protein (HSP20) family

Tissue Specificity : Expressed preferentially in skeletal muscle and heart but not in the lens.

Paythway :

Uniprot ID : Q16082