Product Description
Recombinant Human Heat shock protein beta-2 (HSPB2) is available at Gentaur for Next week Delivery.
Gene Name: HSPB2
Alternative Names : DMPK-binding protein
Expression Region : 1-182aa
AA Sequence : MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 47.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May regulate the kinase DMPK.
Function : May regulate the kinase DMPK.
Involvement in disease :
Subcellular location : Cytoplasm, Nucleus
Protein Families : Small heat shock protein (HSP20) family
Tissue Specificity : Expressed preferentially in skeletal muscle and heart but not in the lens.
Paythway :
Uniprot ID : Q16082
 Euro
            
 British Pound
            
 US Dollar