Recombinant Human Hemoglobin subunit zeta (HBZ)

Product Description

Recombinant Human Hemoglobin subunit zeta (HBZ) is available at Gentaur for Next week Delivery.

Gene Name: HBZ

Alternative Names : HBAZ Hemoglobin zeta chain Zeta-globin

Expression Region : 1-142aa

AA Sequence : SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.

Function : The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.

Involvement in disease :

Subcellular location :

Protein Families : Globin family

Tissue Specificity : Detected in fetal erythrocytes (at protein level).

Paythway :

Uniprot ID : P02008