Recombinant Human Hereditary hemochromatosis protein (HFE), partial

Product Description

Recombinant Human Hereditary hemochromatosis protein (HFE), partial is available at Gentaur for Next week Delivery.

Gene Name: HFE

Alternative Names : HLA-H

Expression Region : 23-306aa

AA Sequence : RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV

Sequence Info : Extracellular Domain

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 40.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Function : Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.

Involvement in disease : Hemochromatosis 1 (HFE1); Variegate porphyria (VP); Microvascular complications of diabetes 7 (MVCD7)

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : MHC class I family

Tissue Specificity : Expressed in all tissues tested except brain.

Paythway :

Uniprot ID : Q30201