Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial

Product Description

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial is available at Gentaur for Next week Delivery.

Gene Name: gG US4

Alternative Names : gG-1

Expression Region : 25-189aa

AA Sequence : VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Chokine-binding protein that inhibits neutrophils' chotaxis.

Function : Chemokine-binding protein that inhibits neutrophils' chemotaxis.

Involvement in disease :

Subcellular location : Virion membrane, Single-pass type I membrane protein

Protein Families : Alphaherpesvirinae glycoprotein G family

Tissue Specificity :

Paythway :

Uniprot ID : P06484