Euro
British Pound
US Dollar
Product Description
Recombinant Human Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), partial is available at Gentaur for Next week Delivery.
Gene Name: HNRNPA1
Alternative Names : Helix-destabilizing protein;Single-strand RNA-binding proteinhnRNP core protein A1
Expression Region : 2-354aa
AA Sequence : SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 40.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication.
Function : Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection
Involvement in disease : Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3 (IBMPFD3); Amyotrophic lateral sclerosis 20 (ALS20)
Subcellular location : Nucleus, Cytoplasm, Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs, Shuttles continuously between the nucleus and the cytoplasm along with mRNA, Component of ribonucleosomes (PubMed:17289661), SUBCELLULAR LOCATION: Cytoplasm
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P09651
