Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G)

Product Description

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) is available at Gentaur for Next week Delivery.

Gene Name: FCER1G

Alternative Names : Fc receptor gamma-chain;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma;FceRI gamma

Expression Region : 19-86aa

AA Sequence : LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 34.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Function : Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : CD3Z/FCER1G family

Tissue Specificity :

Paythway : FcepsilonRIsignalingpathway

Uniprot ID : P30273