Product Description
Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G), partial is available at Gentaur for Next week Delivery.
Gene Name: FCER1G
Alternative Names : Fc receptor gamma-chain;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma;FceRI gamma
Expression Region : 45-86aa
AA Sequence : RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 6.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Function : Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families : CD3Z/FCER1G family
Tissue Specificity :
Paythway : FcepsilonRIsignalingpathway
Uniprot ID : P30273
 Euro
            
 British Pound
            
 US Dollar