Euro
British Pound
US Dollar
Product Description
Recombinant Human High mobility group nucleosome-binding domain-containing protein 4 (HMGN4) is available at Gentaur for Next week Delivery.
Gene Name: HMGN4
Alternative Names :
Expression Region : 1-90aa
AA Sequence : MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 36.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Non-histone chromosomal protein HMG-17-like 3
Function :
Involvement in disease :
Subcellular location : Nucleus
Protein Families : HMGN family
Tissue Specificity :
Paythway :
Uniprot ID : O00479
